PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma2g01830.1
Common NameZOSMA_2G01830
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family TALE
Protein Properties Length: 274aa    MW: 31129 Da    PI: 6.3499
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma2g01830.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox31.33.5e-102172512155
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                     k +yp++++++eLA+++gL+ +q+ +WF N+R ++
  Zosma2g01830.1 217 KWPYPTEADKTELAESTGLDPKQINNWFINQRKRH 251
                     569*****************************885 PP

2ELK35.61.9e-12171192122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ++K+ LlrKYsgyL++LkqEFs
  Zosma2g01830.1 171 DIKEKLLRKYSGYLSGLKQEFS 192
                     58*******************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.4E-154084IPR005540KNOX1
PfamPF037908.5E-184181IPR005540KNOX1
SMARTSM012567.6E-1893144IPR005541KNOX2
PfamPF037911.8E-1998143IPR005541KNOX2
SMARTSM011884.4E-6171192IPR005539ELK domain
PROSITE profilePS5121310.633171191IPR005539ELK domain
PfamPF037892.6E-9171192IPR005539ELK domain
PROSITE profilePS5007113.151191254IPR001356Homeobox domain
SuperFamilySSF466892.35E-20192268IPR009057Homeodomain-like
SMARTSM003897.0E-15193258IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.2E-28196256IPR009057Homeodomain-like
CDDcd000864.12E-14203255No hitNo description
PfamPF059201.2E-17211250IPR008422Homeobox KN domain
PROSITE patternPS000270229252IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MDGWICETRH HNSSSATMHQ DDLHALIARI SPSSTSDSYN TVKAKIAAHP RYPCLLHAYI  60
DCQEVGAPPE IASLLNEIRK EHGGSNRGVS SPCAHLIDAD PELDRFMETY CYVLRKYKSD  120
LARPFDDARS FLTDMELQLT DLCKTGPLEA ITDEAEAEGS TDEELNVGGE DIKEKLLRKY  180
SGYLSGLKQE FSKKKKKGKL PKEARQRLLD WWNIHYKWPY PTEADKTELA ESTGLDPKQI  240
NNWFINQRKR HWKPSESMQY AVMDTLSSAP FYG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006841054.11e-100PREDICTED: homeobox protein knotted-1-like 2
SwissprotQ84JS63e-90KNAT6_ARATH; Homeobox protein knotted-1-like 6
TrEMBLA0A0K9PD670.0A0A0K9PD67_Z
STRINGVIT_17s0000g08710.t015e-96(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP16983892
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.16e-85KNOTTED1-like homeobox gene 6